| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343940.1 | 5prime_partial | 213 | 778-137(-) |
Amino Acid sequence : | |||
| AIEILKLMSSTFLVGLCQAIDLRHLEENLKISVKNAVSHVAKKILTTSQNTMLHPSRFCLKELVEVVEREHIFTYIDDPCSFNYPLMQKLRQVLVNHALANGEAEKELAPSIFLKISEFE EELKALLPKEVDKVRVEFETKKPSIENRIKNCRSYPLYRFVREVAGTDFLTGEKARSPGEEFDEVFTAICEGKLIDPLLDCLKEWNGAPLPIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 13,210.711 | ||
| Theoretical pI: | 10.658 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 54.590 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.393 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343940.1 | complete | 122 | 123-491(+) |
Amino Acid sequence : | |||
| MIIFHQHIGRGAPFHSLRQSNNGSINFPSQIAVNTSSNSSPGERAFSPVKKSVPATSLTNLYKGYDLQFLILFSMDGFLVSNSTRTLSTSLGRRAFNSSSNSLIFKKMEGANSFSASPFA NA* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,210.711 | ||
| Theoretical pI: | 10.658 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 54.590 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.393 | ||
| sheet | 0.197 | ||