| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343941.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
| PLKRQKARMSESEIALPHFALFPAAGMGHLTPFLRLAAVLDSRGCAVTIIAAAPAVSAAEADYLSKFLSIHQHINRLELQLVPHEKSALKNDDPFFIQMERIGNSVHLLLPLLSSLSPPL SAIVVDHPVLSRLSHISIPMYTLITTSARFFSCMVHLTNLASENNEKPNNPLEIPFLGSIPRSSLPPIMLDPNHFFGVAITTNTNCIPKLKGVLINTFSWFESKAIEALRRNGVEHILPV GPLKPLEMSEPLHLPWL | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 12,026.282 | ||
| Theoretical pI: | 8.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 32.700 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.271 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343941.1 | 3prime_partial | 107 | 321-1(-) |
Amino Acid sequence : | |||
| MNGVADAFHLNEERIVVFECRFLVRNKLQFEAVNVLVYGQKFGEVVSFGSANRWRGGDDGNGAAAGIEHRGQAEERGEVSHSGGRKESKVWQSNFRFTHPGFLPFKR | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,026.282 | ||
| Theoretical pI: | 8.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 32.700 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.271 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343941.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
| PLKRQKARMSESEIALPHFALFPAAGMGHLTPFLRLAAVLDSRGCAVTIIAAAPAVSAAEADYLSKFLSIHQHINRLELQLVPHEKSALKNDDPFFIQMERIGNSVHLLLPLLSSLSPPL SAIVVDHPVLSRLSHISIPMYTLITTSARFFSCMVHLTNLASENNEKPNNPLEIPFLGSIPRSSLPPIMLDPNHFFGVAITTNTNCIPKLKGVLINTFSWFESKAIEALRRNGVEHILPV GPLKPLEMSEPLHLPWL | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 12,026.282 | ||
| Theoretical pI: | 8.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 32.700 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.271 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343941.1 | 3prime_partial | 107 | 321-1(-) |
Amino Acid sequence : | |||
| MNGVADAFHLNEERIVVFECRFLVRNKLQFEAVNVLVYGQKFGEVVSFGSANRWRGGDDGNGAAAGIEHRGQAEERGEVSHSGGRKESKVWQSNFRFTHPGFLPFKR | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,026.282 | ||
| Theoretical pI: | 8.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 32.700 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.271 | ||
| sheet | 0.224 | ||