Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343943.1	5prime_partial	209	2-631(+)
Amino Acid sequence :
HPVSTAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVLDGYNLPMEMTPTA NGCTRSVKCAAEDIVVNCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP*
Physicochemical properties
Number of amino acids:		209
Molecular weight:		11,465.609
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		85.903
aromaticity		0.035
GRAVY		-0.697
Secondary Structure Fraction
Helix		0.070
turn		0.417
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343943.1	5prime_partial	195	706-119(-)
Amino Acid sequence :
IKNWYSTPLIAHVHRVQKKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIHHDVLRRALDGARAAVSRRRH LHRQIVAVQDGDVVVVLPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		195
Molecular weight:		11,465.609
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		85.903
aromaticity		0.035
GRAVY		-0.697
Secondary Structure Fraction
Helix		0.070
turn		0.417
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343943.1	5prime_partial	115	3-350(+)
Amino Acid sequence :
TPFPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWTATICRWR*
Physicochemical properties
Number of amino acids:		115
Molecular weight:		11,465.609
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		85.903
aromaticity		0.035
GRAVY		-0.697
Secondary Structure Fraction
Helix		0.070
turn		0.417
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343943.1	5prime_partial	209	2-631(+)
Amino Acid sequence :
HPVSTAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVLDGYNLPMEMTPTA NGCTRSVKCAAEDIVVNCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP*
Physicochemical properties
Number of amino acids:		209
Molecular weight:		11,465.609
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		85.903
aromaticity		0.035
GRAVY		-0.697
Secondary Structure Fraction
Helix		0.070
turn		0.417
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343943.1	5prime_partial	195	706-119(-)
Amino Acid sequence :
IKNWYSTPLIAHVHRVQKKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIHHDVLRRALDGARAAVSRRRH LHRQIVAVQDGDVVVVLPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		195
Molecular weight:		11,465.609
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		85.903
aromaticity		0.035
GRAVY		-0.697
Secondary Structure Fraction
Helix		0.070
turn		0.417
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343943.1	5prime_partial	115	3-350(+)
Amino Acid sequence :
TPFPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWTATICRWR*
Physicochemical properties
Number of amino acids:		115
Molecular weight:		11,465.609
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		85.903
aromaticity		0.035
GRAVY		-0.697
Secondary Structure Fraction
Helix		0.070
turn		0.417
sheet		0.217