| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343956.1 | complete | 129 | 61-450(+) |
Amino Acid sequence : | |||
| MATITACTSTSSIARAALLHKAPAARPAAVGLPSISKMGRVRCSVEGKREESEAKLGMGASMVAAAAMSSPAAMALVDERMSTEGTGLPFGLSNNLLGWILFGVFGLIWALYFVYVSSLE EDEESGMSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,432.445 | ||
| Theoretical pI: | 5.356 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 66.833 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.370 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.271 | ||
| sheet | 0.403 | ||