| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343962.1 | internal | 221 | 2-664(+) |
Amino Acid sequence : | |||
| PMSRTLAVMVLHFVLRDKSSEEQLSNLSEAISSYIADERLGYAEPVPGVELYLCPPASRMFDMLNKHILKERPESDKTIENGLVGVVVWRRPHITNTISPNSSSHQKHAFKKQHSFPPPA KRIQDSPNLTRPPQPQQDEDDDDIPPGFGPGAAPPKEDDDLPEFNFTAPRITPHNSLHKRPVDQVRELIKKYGQGGPSGNVVDRGIPVQPWNDDDDDIPEW | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,830.490 | ||
| Theoretical pI: | 5.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 65.399 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.807 | ||
Secondary Structure Fraction | |||
| Helix | 0.249 | ||
| turn | 0.303 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343962.1 | internal | 221 | 2-664(+) |
Amino Acid sequence : | |||
| PMSRTLAVMVLHFVLRDKSSEEQLSNLSEAISSYIADERLGYAEPVPGVELYLCPPASRMFDMLNKHILKERPESDKTIENGLVGVVVWRRPHITNTISPNSSSHQKHAFKKQHSFPPPA KRIQDSPNLTRPPQPQQDEDDDDIPPGFGPGAAPPKEDDDLPEFNFTAPRITPHNSLHKRPVDQVRELIKKYGQGGPSGNVVDRGIPVQPWNDDDDDIPEW | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,830.490 | ||
| Theoretical pI: | 5.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 65.399 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.807 | ||
Secondary Structure Fraction | |||
| Helix | 0.249 | ||
| turn | 0.303 | ||
| sheet | 0.195 | ||