| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343963.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| RVERNRIPPISPPTMALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPA INVNDS | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 16,324.535 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.824 | ||
| aromaticity | 0.022 | ||
| GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.309 | ||
| sheet | 0.151 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343963.1 | 5prime_partial | 158 | 739-263(-) |
Amino Acid sequence : | |||
| RVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILGRILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAPIKRALGAPPVFLES LPLPGEDGGAVARDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 16,324.535 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.824 | ||
| aromaticity | 0.022 | ||
| GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.309 | ||
| sheet | 0.151 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343963.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
| PRRKKQNPPNFPSYNGAPCRENQLRPRIQGQGHVSGRLRPPRNRPGRGRDARPHVVPHRIRPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRARQRRR LRLEGGDSPGILVVHRARA* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 16,324.535 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.824 | ||
| aromaticity | 0.022 | ||
| GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.309 | ||
| sheet | 0.151 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343963.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| RVERNRIPPISPPTMALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPA INVNDS | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 16,324.535 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.824 | ||
| aromaticity | 0.022 | ||
| GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.309 | ||
| sheet | 0.151 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343963.1 | 5prime_partial | 158 | 739-263(-) |
Amino Acid sequence : | |||
| RVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILGRILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAPIKRALGAPPVFLES LPLPGEDGGAVARDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 16,324.535 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.824 | ||
| aromaticity | 0.022 | ||
| GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.309 | ||
| sheet | 0.151 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343963.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
| PRRKKQNPPNFPSYNGAPCRENQLRPRIQGQGHVSGRLRPPRNRPGRGRDARPHVVPHRIRPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRARQRRR LRLEGGDSPGILVVHRARA* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 16,324.535 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.824 | ||
| aromaticity | 0.022 | ||
| GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.309 | ||
| sheet | 0.151 | ||