Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343963.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
RVERNRIPPISPPTMALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPA INVNDS | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 16,324.535 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 79.824 | ||
aromaticity | 0.022 | ||
GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.309 | ||
sheet | 0.151 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343963.1 | 5prime_partial | 158 | 739-263(-) |
Amino Acid sequence : | |||
RVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILGRILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAPIKRALGAPPVFLES LPLPGEDGGAVARDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 16,324.535 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 79.824 | ||
aromaticity | 0.022 | ||
GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.309 | ||
sheet | 0.151 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343963.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
PRRKKQNPPNFPSYNGAPCRENQLRPRIQGQGHVSGRLRPPRNRPGRGRDARPHVVPHRIRPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRARQRRR LRLEGGDSPGILVVHRARA* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 16,324.535 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 79.824 | ||
aromaticity | 0.022 | ||
GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.309 | ||
sheet | 0.151 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343963.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
RVERNRIPPISPPTMALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPA INVNDS | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 16,324.535 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 79.824 | ||
aromaticity | 0.022 | ||
GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.309 | ||
sheet | 0.151 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343963.1 | 5prime_partial | 158 | 739-263(-) |
Amino Acid sequence : | |||
RVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILGRILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAPIKRALGAPPVFLES LPLPGEDGGAVARDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 16,324.535 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 79.824 | ||
aromaticity | 0.022 | ||
GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.309 | ||
sheet | 0.151 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343963.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
PRRKKQNPPNFPSYNGAPCRENQLRPRIQGQGHVSGRLRPPRNRPGRGRDARPHVVPHRIRPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRARQRRR LRLEGGDSPGILVVHRARA* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 16,324.535 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 79.824 | ||
aromaticity | 0.022 | ||
GRAVY | -1.548 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.309 | ||
sheet | 0.151 |