| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343974.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| KTKDPHGLGFAKSSDFVRVSNLRRVKFGRTKVSVIRNSTNPGSETVELEPASEGSQLLVPRQKYCESIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMRIADQGA DIVRITVQGKKEADACFDIKNTLVQKNYNIPLVADIHFAPAVALRVAECFDKIRVNPGNFADRRAQFEQLEYTDDDYQKELEHIEKVFTPLVEKCKKYGRAMRIGTNHGSLSDRIMSFYG DSP | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 15,839.540 | ||
| Theoretical pI: | 8.840 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 13115 | ||
| Instability index: | 30.443 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.387 | ||
| turn | 0.296 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343974.1 | complete | 142 | 685-257(-) |
Amino Acid sequence : | |||
| MVCPNTHCSAILLAFFNQWGENLLNMLKFFLVVVICVFQLLKLCPPISKVSRVNTDFIKTFSNSQSNSWSKVNVCHQRDVVVLLNKGVLYIKTCIRFLLSLHSNSNNICSLICNSHNLLN SSSNILCICSGHCLNSDGMLTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,839.540 | ||
| Theoretical pI: | 8.840 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 13115 | ||
| Instability index: | 30.443 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.387 | ||
| turn | 0.296 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343974.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| KTKDPHGLGFAKSSDFVRVSNLRRVKFGRTKVSVIRNSTNPGSETVELEPASEGSQLLVPRQKYCESIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMRIADQGA DIVRITVQGKKEADACFDIKNTLVQKNYNIPLVADIHFAPAVALRVAECFDKIRVNPGNFADRRAQFEQLEYTDDDYQKELEHIEKVFTPLVEKCKKYGRAMRIGTNHGSLSDRIMSFYG DSP | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 15,839.540 | ||
| Theoretical pI: | 8.840 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 13115 | ||
| Instability index: | 30.443 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.387 | ||
| turn | 0.296 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343974.1 | complete | 142 | 685-257(-) |
Amino Acid sequence : | |||
| MVCPNTHCSAILLAFFNQWGENLLNMLKFFLVVVICVFQLLKLCPPISKVSRVNTDFIKTFSNSQSNSWSKVNVCHQRDVVVLLNKGVLYIKTCIRFLLSLHSNSNNICSLICNSHNLLN SSSNILCICSGHCLNSDGMLTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,839.540 | ||
| Theoretical pI: | 8.840 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 13115 | ||
| Instability index: | 30.443 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.387 | ||
| turn | 0.296 | ||
| sheet | 0.197 | ||