| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343976.1 | complete | 123 | 152-523(+) |
Amino Acid sequence : | |||
| MHQYHDAVRASCTILRLADDMGTSLDEVERGDVPKSLQCCMNEKKCGEEDARKHVRSMIEETWKLMNTELMRVDSPFSKHFLEAAANLGRMAQFVYQDGSDGFGMQHSKVNKLLRGLLFE PHA* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,097.917 | ||
| Theoretical pI: | 8.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 62.369 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.299 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343976.1 | complete | 107 | 380-57(-) |
Amino Acid sequence : | |||
| MENQRASALCSSTSMSPLSLISRASEHLLPRISSHSCNIEGISVHRLSQPHPVMFPCHQQALEWCMRLEPHRGIDAFCRHPPFSLNSLAGKRYGIISEHLLLIPMHY* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,097.917 | ||
| Theoretical pI: | 8.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 62.369 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.299 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343976.1 | complete | 123 | 152-523(+) |
Amino Acid sequence : | |||
| MHQYHDAVRASCTILRLADDMGTSLDEVERGDVPKSLQCCMNEKKCGEEDARKHVRSMIEETWKLMNTELMRVDSPFSKHFLEAAANLGRMAQFVYQDGSDGFGMQHSKVNKLLRGLLFE PHA* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,097.917 | ||
| Theoretical pI: | 8.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 62.369 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.299 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343976.1 | complete | 107 | 380-57(-) |
Amino Acid sequence : | |||
| MENQRASALCSSTSMSPLSLISRASEHLLPRISSHSCNIEGISVHRLSQPHPVMFPCHQQALEWCMRLEPHRGIDAFCRHPPFSLNSLAGKRYGIISEHLLLIPMHY* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,097.917 | ||
| Theoretical pI: | 8.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 62.369 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.299 | ||
| sheet | 0.280 | ||