| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343979.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
| RIEACMGVLRLARAYTGREKIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPRAATYETLTSPYNDVAAVEKLFNENKGELAAVILEPVVGNAGFIPPKPDFLNFLRKITKDDGTLL IFDEVMTGFRISYGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKQPGTYEYLDKITGELIQGIVEAGKKAGHAISGGYINGM FGFFFTDGPVYNFE | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 13,935.843 | ||
| Theoretical pI: | 8.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 53.048 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.238 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343979.1 | 5prime_partial | 122 | 762-394(-) |
Amino Acid sequence : | |||
| LKIINRAISEEETKHSVYIATAYCMTGFLPSFHNALYEFAGNLVQVLIRARLFQPLKRVNPGSHRQWVSTECAGLIHWPCRSNHLHYLPPSTICTDWQTTTNNLSKSCQIRSYSEILLST TV* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,935.843 | ||
| Theoretical pI: | 8.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 53.048 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.238 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343979.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
| RIEACMGVLRLARAYTGREKIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPRAATYETLTSPYNDVAAVEKLFNENKGELAAVILEPVVGNAGFIPPKPDFLNFLRKITKDDGTLL IFDEVMTGFRISYGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKQPGTYEYLDKITGELIQGIVEAGKKAGHAISGGYINGM FGFFFTDGPVYNFE | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 13,935.843 | ||
| Theoretical pI: | 8.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 53.048 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.238 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343979.1 | 5prime_partial | 122 | 762-394(-) |
Amino Acid sequence : | |||
| LKIINRAISEEETKHSVYIATAYCMTGFLPSFHNALYEFAGNLVQVLIRARLFQPLKRVNPGSHRQWVSTECAGLIHWPCRSNHLHYLPPSTICTDWQTTTNNLSKSCQIRSYSEILLST TV* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,935.843 | ||
| Theoretical pI: | 8.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 53.048 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.238 | ||
| sheet | 0.221 | ||