| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343980.1 | 5prime_partial | 189 | 758-189(-) |
Amino Acid sequence : | |||
| DEVMTGFRISYGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKQPGTYEYLDKITGELIQGIVEAGKKAGHAISGGYINGMFG FFFTDGPVYNFEDAKKSDTAKFAKFYRAMLEEGVYFAPSQFEAGFTGLSHTSEDIQKTIAAAEKVFQTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 18,419.164 | ||
| Theoretical pI: | 9.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 57.680 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.219 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343980.1 | complete | 160 | 249-731(+) |
Amino Acid sequence : | |||
| MRQAGKPGLKLRRCEIHTFLQHRPVELGEFRSITLLRILKIINRAISEEETKHSVYIATAYCMTGFLPSFHNALYEFAGNLVQVLIRARLFQPLKRVNPGSHRQWVSTECAGLIHWPCRS NHLHYLPPSTICTDWQTTTNNLSKSCQIRSYSEILLSTTV* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,419.164 | ||
| Theoretical pI: | 9.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 57.680 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.219 | ||
| sheet | 0.238 | ||