| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343983.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| LIFMPFYDYVYGTIDKSSDALYESSLVRKEDVPDVVHLTHLTTPESIFHLRLGFAHFASQPYISKWYLWLMWPLTVWSMMITWIYGRTFVVERNIFKNLKLQTWALPKYTIQYYMQWQRE WINNLIEDAIVEADAKGVKVLSLGLLNQEEGLNRNGEIFLRRNPQLKVKLVDGSSLAVAIVLNSIPKGTTQVVLRGNITKVAYSIALALCQDGKFQVYTLNEDDYKKLKVNINSEAANNL ILSKRPS | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 28,541.759 | ||
| Theoretical pI: | 8.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 63370 63370 | ||
| Instability index: | 34.702 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.401 | ||
| turn | 0.206 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343983.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| LIFMPFYDYVYGTIDKSSDALYESSLVRKEDVPDVVHLTHLTTPESIFHLRLGFAHFASQPYISKWYLWLMWPLTVWSMMITWIYGRTFVVERNIFKNLKLQTWALPKYTIQYYMQWQRE WINNLIEDAIVEADAKGVKVLSLGLLNQEEGLNRNGEIFLRRNPQLKVKLVDGSSLAVAIVLNSIPKGTTQVVLRGNITKVAYSIALALCQDGKFQVYTLNEDDYKKLKVNINSEAANNL ILSKRPS | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 28,541.759 | ||
| Theoretical pI: | 8.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 63370 63370 | ||
| Instability index: | 34.702 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.401 | ||
| turn | 0.206 | ||
| sheet | 0.251 | ||