Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343987.1 | 5prime_partial | 214 | 1-645(+) |
Amino Acid sequence : | |||
KNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVAS GLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAAYGHFGRDDPDFTWETVKVLKPKA* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 23,300.324 | ||
Theoretical pI: | 9.062 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 6.962 | ||
aromaticity | 0.084 | ||
GRAVY | -0.233 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.224 | ||
sheet | 0.187 |