| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343993.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
| NSVGGDSGSSGHSNESIMMEQGIHTLLLHHKSAGERPPVTFAIAAQGKDEIHVSECPCFLVSGTSQAMTAKEMWTEVKENMSFDNIKPYENPSLSEVGSSIGAALAATVHIPPCSSREVT FSLAWDCPEIRFPSGKTYRRRYTKFYGVDGDAAPRIASDAILGNICYFFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 18,409.481 | ||
| Theoretical pI: | 5.643 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 51.832 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.300 | ||
| sheet | 0.235 | ||