Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343995.1	5prime_partial	132	1-399(+)
Amino Acid sequence :
APPLYRPTVMVTNDDGLYAPGLRALVHLLVSSNRFNIFVSAPHSENSAASHSISWQKAISAKQVEIDGAVAFAISGTPADCTCLGVSKVLFPSIPDLVISGINMGCNSGYNMDCSRGSRS VSLWDTFYIFII*
Physicochemical properties
Number of amino acids:		132
Molecular weight:		14,110.990
Theoretical pI:		6.290
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17210
Instability index:		39.657
aromaticity		0.091
GRAVY		0.301
Secondary Structure Fraction
Helix		0.333
turn		0.318
sheet		0.205