Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343998.1 | internal | 246 | 740-3(-) |
Amino Acid sequence : | |||
DDDLATCETSIAVWTADDKAARRVEVEDGLLVEVLLGDNGLDHVLLEIGSNFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQ LGGLVRGIAKHVTLVTSTDFFRSFGEVAVNTLSNIRALLLNIHQNLAIISIKAYIIRNKSNGTASVTDNLLVVDISLGCNLSEHHDHVSLGACLTGNLAVRVLSETGIKHRIGDLIAQLV GVALIQ | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 26,932.200 | ||
Theoretical pI: | 5.065 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 30.967 | ||
aromaticity | 0.049 | ||
GRAVY | -0.301 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.199 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343998.1 | internal | 246 | 3-740(+) |
Amino Acid sequence : | |||
LNEGHPDKLCDQVPYAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYA TDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLT GRKIII | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 26,932.200 | ||
Theoretical pI: | 5.065 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 30.967 | ||
aromaticity | 0.049 | ||
GRAVY | -0.301 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.199 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343998.1 | internal | 246 | 740-3(-) |
Amino Acid sequence : | |||
DDDLATCETSIAVWTADDKAARRVEVEDGLLVEVLLGDNGLDHVLLEIGSNFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQ LGGLVRGIAKHVTLVTSTDFFRSFGEVAVNTLSNIRALLLNIHQNLAIISIKAYIIRNKSNGTASVTDNLLVVDISLGCNLSEHHDHVSLGACLTGNLAVRVLSETGIKHRIGDLIAQLV GVALIQ | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 26,932.200 | ||
Theoretical pI: | 5.065 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 30.967 | ||
aromaticity | 0.049 | ||
GRAVY | -0.301 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.199 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343998.1 | internal | 246 | 3-740(+) |
Amino Acid sequence : | |||
LNEGHPDKLCDQVPYAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYA TDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLT GRKIII | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 26,932.200 | ||
Theoretical pI: | 5.065 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 30.967 | ||
aromaticity | 0.049 | ||
GRAVY | -0.301 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.199 | ||
sheet | 0.224 |