| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344010.1 | 3prime_partial | 152 | 457-2(-) |
Amino Acid sequence : | |||
| MDDPAQDQNPARILRVIIEISQAAGWQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAGGADEEIEKLRNFGLCAGTMRALMEVGNTLAIEKIVRRLKDLALKEME GFPGEKAELMWNLVAEPSRAVTRRGIKEMYLC | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 14,021.925 | ||
| Theoretical pI: | 11.035 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 64.036 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.377 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344010.1 | 5prime_partial | 130 | 3-395(+) |
Amino Acid sequence : | |||
| HKYISLIPRRVTARLGSATRFHISSAFSPGKPSISLRAKSFNLLTIFSIARVFPTSINALIVPAQSPKFLNFSISSSAPPANMAPQAAPQPWISPYFFRHTYSTNPNLESGSTISASLYS PSISPCQPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,021.925 | ||
| Theoretical pI: | 11.035 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 64.036 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.377 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344010.1 | 3prime_partial | 152 | 457-2(-) |
Amino Acid sequence : | |||
| MDDPAQDQNPARILRVIIEISQAAGWQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAGGADEEIEKLRNFGLCAGTMRALMEVGNTLAIEKIVRRLKDLALKEME GFPGEKAELMWNLVAEPSRAVTRRGIKEMYLC | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 14,021.925 | ||
| Theoretical pI: | 11.035 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 64.036 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.377 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344010.1 | 5prime_partial | 130 | 3-395(+) |
Amino Acid sequence : | |||
| HKYISLIPRRVTARLGSATRFHISSAFSPGKPSISLRAKSFNLLTIFSIARVFPTSINALIVPAQSPKFLNFSISSSAPPANMAPQAAPQPWISPYFFRHTYSTNPNLESGSTISASLYS PSISPCQPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,021.925 | ||
| Theoretical pI: | 11.035 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 64.036 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.377 | ||
| sheet | 0.200 | ||