| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344019.1 | 5prime_partial | 115 | 1-348(+) |
Amino Acid sequence : | |||
| KXCWLFKSGKVYDVTPFMEDHPGGDEVLLSSKGKDATNDFEDVGHSDSAREMMDKYYIGDIDMTTVPLKRSYVAPRQPAYNPDKTPEFVIKILQFLVPLLILGLAFAVRHYTKEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,986.777 | ||
| Theoretical pI: | 5.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 40.028 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.202 | ||
| sheet | 0.228 | ||