| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344021.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| TPLFLTSNPALLAQPLSLQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAA VFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFP AINVNDSV | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 24,483.336 | ||
| Theoretical pI: | 5.029 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.288 | ||
| aromaticity | 0.013 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.287 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344021.1 | 5prime_partial | 237 | 746-33(-) |
Amino Acid sequence : | |||
| DRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQ GLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAAGGGLLHLERQGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 24,483.336 | ||
| Theoretical pI: | 5.029 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.288 | ||
| aromaticity | 0.013 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.287 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344021.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| TPLFLTSNPALLAQPLSLQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAA VFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFP AINVNDSV | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 24,483.336 | ||
| Theoretical pI: | 5.029 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.288 | ||
| aromaticity | 0.013 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.287 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344021.1 | 5prime_partial | 237 | 746-33(-) |
Amino Acid sequence : | |||
| DRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQ GLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAAGGGLLHLERQGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 24,483.336 | ||
| Theoretical pI: | 5.029 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.288 | ||
| aromaticity | 0.013 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.287 | ||
| sheet | 0.333 | ||