Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344025.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
TDDKVTIESAEATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCKNVPRLIPGWTKPICIGRHAFGDQYRATDAVIKGPGKLKLVFVPESGEKTEMEVYDF TGAGGVALSMYNTDESIRSFAESSMNTAYLKKWPLYLSTKNTILKKYDGRFKDIFQEVYESQWKAKFEEAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQRFGSLGLMT SVLVCP | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 27,764.512 | ||
Theoretical pI: | 7.492 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51130 | ||
Instability index: | 28.527 | ||
aromaticity | 0.118 | ||
GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.211 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344025.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
TDDKVTIESAEATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCKNVPRLIPGWTKPICIGRHAFGDQYRATDAVIKGPGKLKLVFVPESGEKTEMEVYDF TGAGGVALSMYNTDESIRSFAESSMNTAYLKKWPLYLSTKNTILKKYDGRFKDIFQEVYESQWKAKFEEAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQRFGSLGLMT SVLVCP | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 27,764.512 | ||
Theoretical pI: | 7.492 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51130 | ||
Instability index: | 28.527 | ||
aromaticity | 0.118 | ||
GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.211 | ||
sheet | 0.240 |