Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344038.1	5prime_partial	122	1-369(+)
Amino Acid sequence :
ESWRCPKIDFREGPALPVLDQMVADGKYEGSFDFIFVDADKDNYLNYHKRLIELVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRR II*
Physicochemical properties
Number of amino acids:		122
Molecular weight:		13,920.859
Theoretical pI:		5.371
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21430 21555
Instability index:		38.873
aromaticity		0.115
GRAVY		-0.160
Secondary Structure Fraction
Helix		0.377
turn		0.205
sheet		0.221