| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344041.1 | 5prime_partial | 250 | 2-754(+) |
Amino Acid sequence : | |||
| TPLGLGFMEAAGLTTFHPVMSTTEFWTSHECLLLPYEQALTRKDSTSGLYYGCSAHMLWVGERTRQLDGAHVEFLRGVSNPLGIKVSQKMDPNELTKLVDILNPTNKPGRITVIVRMGAE NMRVKLPHLIRAVRRAGQIVTWVCDPMHGNTIKAPCGLKTRAFDAILAEVRAFFDVHEQEGSHAGGIHLEMTGQNVTECIGGSRTVTYDDLSSRYHTHCDPRLNASQSLELAFIVSERLR KKRMASQRLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 18,482.608 | ||
| Theoretical pI: | 5.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 56.563 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.263 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344041.1 | complete | 167 | 565-62(-) |
Amino Acid sequence : | |||
| MDSTSVAAFLLMHVEESPHLRQDCIESAGFEATGCLDCVPMHRVTYPSYNLSGSSDCPDQMRKLNSHVLSTHSNDDCDSPRLVGGIQDVDEFSEFIGIHLLAHLDTKRIGNSSQEFNVGT VELPSTFTNPKHVGRTAIVETRSRIFPGECLFIRQQQALVRGPKFSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,482.608 | ||
| Theoretical pI: | 5.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 56.563 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.263 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344041.1 | 5prime_partial | 250 | 2-754(+) |
Amino Acid sequence : | |||
| TPLGLGFMEAAGLTTFHPVMSTTEFWTSHECLLLPYEQALTRKDSTSGLYYGCSAHMLWVGERTRQLDGAHVEFLRGVSNPLGIKVSQKMDPNELTKLVDILNPTNKPGRITVIVRMGAE NMRVKLPHLIRAVRRAGQIVTWVCDPMHGNTIKAPCGLKTRAFDAILAEVRAFFDVHEQEGSHAGGIHLEMTGQNVTECIGGSRTVTYDDLSSRYHTHCDPRLNASQSLELAFIVSERLR KKRMASQRLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 18,482.608 | ||
| Theoretical pI: | 5.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 56.563 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.263 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344041.1 | complete | 167 | 565-62(-) |
Amino Acid sequence : | |||
| MDSTSVAAFLLMHVEESPHLRQDCIESAGFEATGCLDCVPMHRVTYPSYNLSGSSDCPDQMRKLNSHVLSTHSNDDCDSPRLVGGIQDVDEFSEFIGIHLLAHLDTKRIGNSSQEFNVGT VELPSTFTNPKHVGRTAIVETRSRIFPGECLFIRQQQALVRGPKFSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,482.608 | ||
| Theoretical pI: | 5.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 56.563 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.263 | ||
| sheet | 0.210 | ||