| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344044.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
| SCFKMSNMFASVAPISTNNTTVVDMRRSVTYHPSVWKDHFLDYASGITEVEMEQLQKQKERIKTLLAQTPDDSVLKIELIDAIQQLGVGYHFEKEINHSLRQIYDTFQISSKDNDIRVVA LHFRLLRQHGYPVPSDVFKKFIDNQGRLEESVMNNVEGMLSLYEASNYGMEGEDILDKALEISTSHLEPLASHSRRINEALEMPISKTLVRLGARKFISIYEEDESRDEDLLKFAKLDFN ILQKIHQEELTHIVRWWKE | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 30,103.868 | ||
| Theoretical pI: | 5.517 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 48.891 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.434 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.189 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344044.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
| SCFKMSNMFASVAPISTNNTTVVDMRRSVTYHPSVWKDHFLDYASGITEVEMEQLQKQKERIKTLLAQTPDDSVLKIELIDAIQQLGVGYHFEKEINHSLRQIYDTFQISSKDNDIRVVA LHFRLLRQHGYPVPSDVFKKFIDNQGRLEESVMNNVEGMLSLYEASNYGMEGEDILDKALEISTSHLEPLASHSRRINEALEMPISKTLVRLGARKFISIYEEDESRDEDLLKFAKLDFN ILQKIHQEELTHIVRWWKE | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 30,103.868 | ||
| Theoretical pI: | 5.517 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 48.891 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.434 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.189 | ||
| sheet | 0.270 | ||