| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344048.1 | internal | 262 | 2-787(+) |
Amino Acid sequence : | |||
| YISSAAGIMAPFSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFA AYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPF EYCDLVTTTTHKSLRGPRAGMI | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 14,238.442 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.870 | ||
| aromaticity | 0.026 | ||
| GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.239 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344048.1 | 5prime_partial | 191 | 3-578(+) |
Amino Acid sequence : | |||
| ISPPPPELWPLSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISP PTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 14,238.442 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.870 | ||
| aromaticity | 0.026 | ||
| GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.239 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344048.1 | complete | 134 | 679-275(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,238.442 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.870 | ||
| aromaticity | 0.026 | ||
| GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.239 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344048.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
| LYLLRRRNYGPFLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 14,238.442 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.870 | ||
| aromaticity | 0.026 | ||
| GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.239 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344048.1 | internal | 262 | 2-787(+) |
Amino Acid sequence : | |||
| YISSAAGIMAPFSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFA AYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPF EYCDLVTTTTHKSLRGPRAGMI | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 14,238.442 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.870 | ||
| aromaticity | 0.026 | ||
| GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.239 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344048.1 | 5prime_partial | 191 | 3-578(+) |
Amino Acid sequence : | |||
| ISPPPPELWPLSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISP PTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 14,238.442 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.870 | ||
| aromaticity | 0.026 | ||
| GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.239 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344048.1 | complete | 134 | 679-275(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,238.442 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.870 | ||
| aromaticity | 0.026 | ||
| GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.239 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344048.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
| LYLLRRRNYGPFLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 14,238.442 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 101.870 | ||
| aromaticity | 0.026 | ||
| GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.239 | ||
| sheet | 0.222 | ||