Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344048.1 | internal | 262 | 2-787(+) |
Amino Acid sequence : | |||
YISSAAGIMAPFSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFA AYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPF EYCDLVTTTTHKSLRGPRAGMI | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 14,238.442 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.870 | ||
aromaticity | 0.026 | ||
GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.239 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344048.1 | 5prime_partial | 191 | 3-578(+) |
Amino Acid sequence : | |||
ISPPPPELWPLSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISP PTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 14,238.442 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.870 | ||
aromaticity | 0.026 | ||
GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.239 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344048.1 | complete | 134 | 679-275(-) |
Amino Acid sequence : | |||
MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,238.442 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.870 | ||
aromaticity | 0.026 | ||
GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.239 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344048.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
LYLLRRRNYGPFLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 14,238.442 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.870 | ||
aromaticity | 0.026 | ||
GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.239 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344048.1 | internal | 262 | 2-787(+) |
Amino Acid sequence : | |||
YISSAAGIMAPFSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFA AYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPF EYCDLVTTTTHKSLRGPRAGMI | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 14,238.442 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.870 | ||
aromaticity | 0.026 | ||
GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.239 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344048.1 | 5prime_partial | 191 | 3-578(+) |
Amino Acid sequence : | |||
ISPPPPELWPLSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISP PTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 14,238.442 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.870 | ||
aromaticity | 0.026 | ||
GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.239 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344048.1 | complete | 134 | 679-275(-) |
Amino Acid sequence : | |||
MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,238.442 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.870 | ||
aromaticity | 0.026 | ||
GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.239 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344048.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
LYLLRRRNYGPFLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 14,238.442 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 101.870 | ||
aromaticity | 0.026 | ||
GRAVY | -1.478 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.239 | ||
sheet | 0.222 |