| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344056.1 | 3prime_partial | 217 | 63-713(+) |
Amino Acid sequence : | |||
| MAPAAFWNSSKTVCVMDASGRLGSALVSRLLRRGYTVHAAVHSHDEVYKRQSIEKEELRVFYTDPLDYHSILDALKGCSALFYSFELPSDHPTYDEFMGELEVRAAHNVLEACAQTDTID KVVFTSSATAVVWRDGPQDGLASDVDERNWSDVNFCKKFKLWHGLSKTIAEKTAWALAMDRGVNMVSINAGLLMCPDLSIKDPYLLGAAEMFKDGVL | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 24,130.187 | ||
| Theoretical pI: | 5.331 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
| Instability index: | 31.675 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.106 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.198 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344056.1 | 3prime_partial | 217 | 63-713(+) |
Amino Acid sequence : | |||
| MAPAAFWNSSKTVCVMDASGRLGSALVSRLLRRGYTVHAAVHSHDEVYKRQSIEKEELRVFYTDPLDYHSILDALKGCSALFYSFELPSDHPTYDEFMGELEVRAAHNVLEACAQTDTID KVVFTSSATAVVWRDGPQDGLASDVDERNWSDVNFCKKFKLWHGLSKTIAEKTAWALAMDRGVNMVSINAGLLMCPDLSIKDPYLLGAAEMFKDGVL | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 24,130.187 | ||
| Theoretical pI: | 5.331 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
| Instability index: | 31.675 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.106 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.198 | ||
| sheet | 0.295 | ||