| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344057.1 | 5prime_partial | 209 | 707-78(-) |
Amino Acid sequence : | |||
| IDKVVFTLLATAVVWRDGPQDGLASDVDERNWSDVNFCKKFKLWHGLLKTIAEKTAWALAMDRGVNMVSINAGLLMCPDLSIKDPYLLGAAEMFKDGVLVTVDLEFLVDAHIWVFEDVSL YGRYLCFNGIINCNDDVVKLAKMLLPSLLSPDMFDEDEGVFQQRICNDKLRKLMVDFDSGFQVSSDAEGINLLVCRGKKSMNSLLNYVQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 23,481.980 | ||
| Theoretical pI: | 4.689 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
| Instability index: | 12.268 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.196 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344057.1 | 5prime_partial | 209 | 707-78(-) |
Amino Acid sequence : | |||
| IDKVVFTLLATAVVWRDGPQDGLASDVDERNWSDVNFCKKFKLWHGLLKTIAEKTAWALAMDRGVNMVSINAGLLMCPDLSIKDPYLLGAAEMFKDGVLVTVDLEFLVDAHIWVFEDVSL YGRYLCFNGIINCNDDVVKLAKMLLPSLLSPDMFDEDEGVFQQRICNDKLRKLMVDFDSGFQVSSDAEGINLLVCRGKKSMNSLLNYVQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 23,481.980 | ||
| Theoretical pI: | 4.689 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
| Instability index: | 12.268 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.196 | ||
| sheet | 0.273 | ||