| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344060.1 | internal | 180 | 1-540(+) |
Amino Acid sequence : | |||
| GPVLIHIITEKGKGYPPAEVAADKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYS SFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVDGRRS | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,229.726 | ||
| Theoretical pI: | 5.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19980 | ||
| Instability index: | 49.549 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.211 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344060.1 | internal | 180 | 540-1(-) |
Amino Acid sequence : | |||
| RTAPINYHIWKASHISSVERAAMCGPICPHQSSSVHHEPHRELLEVHVVHHLIVPSLQERRVDRAEWLQSFCCETSGEGDGMLLGDPHVEATVGEALLEDVETGSAPHGRVDGDYFVVLL RFGHEGLREVLCVGFCACFGLHLFPGRWIELHHTMHFICSNFSRRIAFALLRDDVDQHGS | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,229.726 | ||
| Theoretical pI: | 5.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19980 | ||
| Instability index: | 49.549 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.211 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344060.1 | internal | 180 | 1-540(+) |
Amino Acid sequence : | |||
| GPVLIHIITEKGKGYPPAEVAADKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYS SFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVDGRRS | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,229.726 | ||
| Theoretical pI: | 5.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19980 | ||
| Instability index: | 49.549 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.211 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344060.1 | internal | 180 | 540-1(-) |
Amino Acid sequence : | |||
| RTAPINYHIWKASHISSVERAAMCGPICPHQSSSVHHEPHRELLEVHVVHHLIVPSLQERRVDRAEWLQSFCCETSGEGDGMLLGDPHVEATVGEALLEDVETGSAPHGRVDGDYFVVLL RFGHEGLREVLCVGFCACFGLHLFPGRWIELHHTMHFICSNFSRRIAFALLRDDVDQHGS | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 20,229.726 | ||
| Theoretical pI: | 5.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19980 | ||
| Instability index: | 49.549 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.211 | ||
| sheet | 0.261 | ||