| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344062.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| TPFDKIISSNLNFTGLFSPHASNGNTEVYMNGREITKLELRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKATTRFICSLFSLPVPQGQPHGHKDEPSSYATVPNYLEQKKI QKLLLLGLPGSGTSTIFKQAKFLYGNKFTPEELQDIKLMIQSNMYKYLSILLDGRERFEEAVLGINGSTSEEQISESEEGSEQSQCVYSLNPKLKHFSDWLLDIIATGDLDAFFPAATRE YAPLVEEIWR | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 11,590.789 | ||
| Theoretical pI: | 10.989 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 60.222 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.240 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344062.1 | complete | 100 | 178-480(+) |
Amino Acid sequence : | |||
| MMMVVMRKKAKIILEAIYGKRRQPDSSAHCSRCLCPKVSLMGTRTSLAVMPRYQIIWSRKRSRNFFYSASRALEPALFLSRPNFYMGTSLHLKNCRISSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,590.789 | ||
| Theoretical pI: | 10.989 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 60.222 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.240 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344062.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| TPFDKIISSNLNFTGLFSPHASNGNTEVYMNGREITKLELRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWEKATTRFICSLFSLPVPQGQPHGHKDEPSSYATVPNYLEQKKI QKLLLLGLPGSGTSTIFKQAKFLYGNKFTPEELQDIKLMIQSNMYKYLSILLDGRERFEEAVLGINGSTSEEQISESEEGSEQSQCVYSLNPKLKHFSDWLLDIIATGDLDAFFPAATRE YAPLVEEIWR | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 11,590.789 | ||
| Theoretical pI: | 10.989 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 60.222 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.240 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344062.1 | complete | 100 | 178-480(+) |
Amino Acid sequence : | |||
| MMMVVMRKKAKIILEAIYGKRRQPDSSAHCSRCLCPKVSLMGTRTSLAVMPRYQIIWSRKRSRNFFYSASRALEPALFLSRPNFYMGTSLHLKNCRISSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,590.789 | ||
| Theoretical pI: | 10.989 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 60.222 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.240 | ||
| sheet | 0.260 | ||