| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344064.1 | 5prime_partial | 191 | 726-151(-) |
Amino Acid sequence : | |||
| KVIQAMSEVKDFGDPDNLGSCNMTSKEVAIAASCALGQLEAHLGNFSDAEEILTTALKQVEEHFGPQHPKVGVILTCISLMYRLKATKERSSSLLIQEGLLRKAIQLLKAPPLDVEGTDE NVIRKDIIALARGAYAETLLVQQSRKEEGERLKRWAETAWGSRWISLGEALELSESSPRVPVIDTRICRVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 11,102.313 | ||
| Theoretical pI: | 9.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 70.584 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.333 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344064.1 | complete | 102 | 131-439(+) |
Amino Acid sequence : | |||
| MYFVQENYTTLHIRVSITGTLGEDSDNSSASPSDIHRLPQAVSAHRFNRSPSSFLDCCTRSVSAYAPLASAIISFRITFSSVPSTSKGGALSSWIAFRKRPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,102.313 | ||
| Theoretical pI: | 9.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 70.584 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.333 | ||
| sheet | 0.176 | ||