Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344066.1 | complete | 118 | 3-359(+) |
Amino Acid sequence : | |||
MCYSPFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLESKILWVNPDCGLKTRKYGEVKPALENMVAAAKLLRSQLASAK* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 11,130.866 | ||
Theoretical pI: | 9.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 59.199 | ||
aromaticity | 0.110 | ||
GRAVY | 0.172 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.310 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344066.1 | complete | 100 | 310-8(-) |
Amino Acid sequence : | |||
MFSRAGFTSPYLRVLRPQSGFTHKILLSRTASILLILSAISSVDGILGEWMSYTPGPIPAPYFTPSRKTDSSFSSEREFSIVITSASMLMMEWMMSLKGE* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,130.866 | ||
Theoretical pI: | 9.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 59.199 | ||
aromaticity | 0.110 | ||
GRAVY | 0.172 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.310 | ||
sheet | 0.270 |