| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344076.1 | internal | 229 | 687-1(-) |
Amino Acid sequence : | |||
| PVEMTLAGAAEGDGGDLRADNQNPSAGVVLGEVLGHAEDGAAGEAALLVHHEALDGGAEAEEFGELVVGAGHVDAAGGAENEVGDFGFGLPPFLDGLLRRLFPQLRHLHHHDVLPRVQRR RHVRRHVRILLQKLFRQVHVPFPYHRFLAHALEFFFEISFVLAVCNTEVVIRIGALVNAMRGRGGADRQQGGRTLGALSPADLFHRHHFCAGKRNGVFLWLMLRDRVRY | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 23,408.855 | ||
| Theoretical pI: | 9.054 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 45.587 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.183 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344076.1 | 3prime_partial | 208 | 64-687(+) |
Amino Acid sequence : | |||
| MVTVEEIRRAQRAEGPATLLAIGTATPSHCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEITAVTFRGPSESHLDR | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,408.855 | ||
| Theoretical pI: | 9.054 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 45.587 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.183 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344076.1 | internal | 229 | 687-1(-) |
Amino Acid sequence : | |||
| PVEMTLAGAAEGDGGDLRADNQNPSAGVVLGEVLGHAEDGAAGEAALLVHHEALDGGAEAEEFGELVVGAGHVDAAGGAENEVGDFGFGLPPFLDGLLRRLFPQLRHLHHHDVLPRVQRR RHVRRHVRILLQKLFRQVHVPFPYHRFLAHALEFFFEISFVLAVCNTEVVIRIGALVNAMRGRGGADRQQGGRTLGALSPADLFHRHHFCAGKRNGVFLWLMLRDRVRY | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 23,408.855 | ||
| Theoretical pI: | 9.054 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 45.587 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.183 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344076.1 | 3prime_partial | 208 | 64-687(+) |
Amino Acid sequence : | |||
| MVTVEEIRRAQRAEGPATLLAIGTATPSHCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEITAVTFRGPSESHLDR | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,408.855 | ||
| Theoretical pI: | 9.054 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 45.587 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.183 | ||
| sheet | 0.284 | ||