| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344089.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
| ARRFVPNSHEGKMSPENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGD MNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKP RVGTMRELVR | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 28,030.997 | ||
| Theoretical pI: | 8.010 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42400 | ||
| Instability index: | 39.663 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.280 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344089.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
| ARRFVPNSHEGKMSPENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGD MNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKP RVGTMRELVR | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 28,030.997 | ||
| Theoretical pI: | 8.010 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42400 | ||
| Instability index: | 39.663 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.280 | ||
| sheet | 0.260 | ||