| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344091.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
| FGTLFYDVGTSYTAIFARGACGGFVTGFMTFMSIGGFPSFIEEMKIFSRERLNGYYGVAVFILSNFLSSFPFLVAVSVITGTITFYMAFHTEFTRYVFFCLNIFGCIAMVESVMMIVASL VPNFLMGIIAGAGVLGIMMMTAGFFRLLPDLPKIFWRYPVSYIGYGAWALQGSYKNDMIGLVFDPLIPGDPKISGEDVITKMFGVSLHRSKWWDLLALYGLILCYRFLFFVVLKVKERTA VYFQSIYAKRALHNF | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 14,429.413 | ||
| Theoretical pI: | 6.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 44055 | ||
| Instability index: | 42.447 | ||
| aromaticity | 0.164 | ||
| GRAVY | 0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.197 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344091.1 | 5prime_partial | 122 | 2-370(+) |
Amino Acid sequence : | |||
| VRNSILRCGHQLHCYLRPRGLWWLCYRFHDLHVHWRIPFLHRGDEDLFPGETEWLLRRSCVHTVQLPVFLPLLGCGFCDYWDYNFLHGVSYGVHALCLLLSEYIWVHCYGGECDDDCGFT GS* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,429.413 | ||
| Theoretical pI: | 6.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 44055 | ||
| Instability index: | 42.447 | ||
| aromaticity | 0.164 | ||
| GRAVY | 0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.197 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344091.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
| FGTLFYDVGTSYTAIFARGACGGFVTGFMTFMSIGGFPSFIEEMKIFSRERLNGYYGVAVFILSNFLSSFPFLVAVSVITGTITFYMAFHTEFTRYVFFCLNIFGCIAMVESVMMIVASL VPNFLMGIIAGAGVLGIMMMTAGFFRLLPDLPKIFWRYPVSYIGYGAWALQGSYKNDMIGLVFDPLIPGDPKISGEDVITKMFGVSLHRSKWWDLLALYGLILCYRFLFFVVLKVKERTA VYFQSIYAKRALHNF | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 14,429.413 | ||
| Theoretical pI: | 6.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 44055 | ||
| Instability index: | 42.447 | ||
| aromaticity | 0.164 | ||
| GRAVY | 0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.197 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344091.1 | 5prime_partial | 122 | 2-370(+) |
Amino Acid sequence : | |||
| VRNSILRCGHQLHCYLRPRGLWWLCYRFHDLHVHWRIPFLHRGDEDLFPGETEWLLRRSCVHTVQLPVFLPLLGCGFCDYWDYNFLHGVSYGVHALCLLLSEYIWVHCYGGECDDDCGFT GS* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,429.413 | ||
| Theoretical pI: | 6.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 44055 | ||
| Instability index: | 42.447 | ||
| aromaticity | 0.164 | ||
| GRAVY | 0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.197 | ||
| sheet | 0.205 | ||