Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344100.1	5prime_partial	117	3-356(+)
Amino Acid sequence :
LTGSMFESVPKADPIMLMFVLHNWSDNECIDILKRCKEAIPAETGRVMIIDAIIDEDGEGDEFAGARLGLDVTMMAVTFEGKERTHREWAYILTEAGFRKYVVNNIKALESLIEAYP*
Physicochemical properties
Number of amino acids:		117
Molecular weight:		13,184.033
Theoretical pI:		4.614
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		31.202
aromaticity		0.085
GRAVY		-0.032
Secondary Structure Fraction
Helix		0.316
turn		0.171
sheet		0.333