Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344103.1 | 3prime_partial | 227 | 82-762(+) |
Amino Acid sequence : | |||
MGSKPVEDLIEASSRVHFSGFHLKNADPSTLVVEQPTTSATENMKQPFVIGVAGGAASGKTTVCDMIIEQLRDQRVVLVNQDSFYRNLSPEALKKVHEYNFDHPDAFDTEQLLSIMDKLK HGQAVDIPRYDFKSYKNDVFPARRVNPSDVIILEGILIFHDTRVRDFMNMKIFVDTDADVRLARRIRRDTVEKGRDIGMVLDQYSKFVKPAFDDFILPTKKFADIII | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 25,851.286 | ||
Theoretical pI: | 6.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 35.528 | ||
aromaticity | 0.088 | ||
GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.185 | ||
sheet | 0.203 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344103.1 | 3prime_partial | 227 | 82-762(+) |
Amino Acid sequence : | |||
MGSKPVEDLIEASSRVHFSGFHLKNADPSTLVVEQPTTSATENMKQPFVIGVAGGAASGKTTVCDMIIEQLRDQRVVLVNQDSFYRNLSPEALKKVHEYNFDHPDAFDTEQLLSIMDKLK HGQAVDIPRYDFKSYKNDVFPARRVNPSDVIILEGILIFHDTRVRDFMNMKIFVDTDADVRLARRIRRDTVEKGRDIGMVLDQYSKFVKPAFDDFILPTKKFADIII | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 25,851.286 | ||
Theoretical pI: | 6.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 35.528 | ||
aromaticity | 0.088 | ||
GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.185 | ||
sheet | 0.203 |