| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344127.1 | 3prime_partial | 186 | 109-666(+) |
Amino Acid sequence : | |||
| MEESIGKYFNFNLSKEQKKFLVDKGVYLSPFSWKHHSHPGCKTIENWLLYNEIGFHIRHICRDSSVAFLSLREGKLKNLEKIHFRQGNNDQTNDKIRSFNKIHSPKDCLRYSSFSDRETL YQSFRDIGMKMEKRSCYFIHDECHYWNPADLDRFIKYTDAESIMFTVIHPVEVDVGKTSSHLPFLY | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 22,154.936 | ||
| Theoretical pI: | 8.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
| Instability index: | 51.932 | ||
| aromaticity | 0.140 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.226 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344127.1 | 3prime_partial | 186 | 109-666(+) |
Amino Acid sequence : | |||
| MEESIGKYFNFNLSKEQKKFLVDKGVYLSPFSWKHHSHPGCKTIENWLLYNEIGFHIRHICRDSSVAFLSLREGKLKNLEKIHFRQGNNDQTNDKIRSFNKIHSPKDCLRYSSFSDRETL YQSFRDIGMKMEKRSCYFIHDECHYWNPADLDRFIKYTDAESIMFTVIHPVEVDVGKTSSHLPFLY | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 22,154.936 | ||
| Theoretical pI: | 8.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
| Instability index: | 51.932 | ||
| aromaticity | 0.140 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.226 | ||
| sheet | 0.177 | ||