| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344133.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| RFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEALNAEEAFKLAGVNGGFFELQPKEGLALV NGTAVGSGLASIALYEANILAVLSEVMSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSVYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRTATKMIEREIN SVNDNPLIDVSRNKALHGGNFQGTPIGVSMDN | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 12,345.182 | ||
| Theoretical pI: | 8.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 48.314 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344133.1 | 5prime_partial | 108 | 3-329(+) |
Amino Acid sequence : | |||
| IRKWNRIKSHITPHSNQSSNACEDQHPPSRLLRHQIRDLGSHHQIPQPQHHSLLASPRHHHRLRRSRPLILHRRPSHRPPQLQGRWPHRRSPQCRGSLQACRRQRRLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,345.182 | ||
| Theoretical pI: | 8.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 48.314 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344133.1 | 5prime_partial | 107 | 816-493(-) |
Amino Acid sequence : | |||
| IVHRHSNWCPLEVATVQSLVSRNIDQRVVVDRVDLPLDHLGGGADDFYLWAQPLRRCAESVSVLFRLLQRIHLMQFLSSFNVNAPIKNVLHYSGSFDLARMVLQFMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,345.182 | ||
| Theoretical pI: | 8.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 48.314 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344133.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| RFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEALNAEEAFKLAGVNGGFFELQPKEGLALV NGTAVGSGLASIALYEANILAVLSEVMSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSVYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRTATKMIEREIN SVNDNPLIDVSRNKALHGGNFQGTPIGVSMDN | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 12,345.182 | ||
| Theoretical pI: | 8.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 48.314 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344133.1 | 5prime_partial | 108 | 3-329(+) |
Amino Acid sequence : | |||
| IRKWNRIKSHITPHSNQSSNACEDQHPPSRLLRHQIRDLGSHHQIPQPQHHSLLASPRHHHRLRRSRPLILHRRPSHRPPQLQGRWPHRRSPQCRGSLQACRRQRRLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,345.182 | ||
| Theoretical pI: | 8.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 48.314 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344133.1 | 5prime_partial | 107 | 816-493(-) |
Amino Acid sequence : | |||
| IVHRHSNWCPLEVATVQSLVSRNIDQRVVVDRVDLPLDHLGGGADDFYLWAQPLRRCAESVSVLFRLLQRIHLMQFLSSFNVNAPIKNVLHYSGSFDLARMVLQFMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,345.182 | ||
| Theoretical pI: | 8.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 48.314 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||