| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344136.1 | 5prime_partial | 176 | 678-148(-) |
Amino Acid sequence : | |||
| ASATYPLDLVRTRLTAQRNVIYYKGIFHALRTISKEEGFRGLYKGLGPTLLGVGPNLAISFSVYDTARSYWQLHRPDDSTVLTSLACGSLSGVASSTVSYPLDLVRRRMQLEGAGGRARV YRTGLVGTVRSIIRKEGWRGLYRGILPEYYKVVPSVGIVFMTYEKLKQILSSIPEN* | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,579.403 | ||
| Theoretical pI: | 10.037 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 28880 | ||
| Instability index: | 31.792 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.256 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344136.1 | 5prime_partial | 176 | 678-148(-) |
Amino Acid sequence : | |||
| ASATYPLDLVRTRLTAQRNVIYYKGIFHALRTISKEEGFRGLYKGLGPTLLGVGPNLAISFSVYDTARSYWQLHRPDDSTVLTSLACGSLSGVASSTVSYPLDLVRRRMQLEGAGGRARV YRTGLVGTVRSIIRKEGWRGLYRGILPEYYKVVPSVGIVFMTYEKLKQILSSIPEN* | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,579.403 | ||
| Theoretical pI: | 10.037 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 28880 | ||
| Instability index: | 31.792 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.256 | ||
| sheet | 0.227 | ||