| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344138.1 | complete | 128 | 340-726(+) |
Amino Acid sequence : | |||
| MRKLREASSILRPVHLLWLIISVVNKHIKLYELRWINLDILQHQHFISFTLGRLPNQNPSSLAQSERESFFTNHRIFQQIFNFSRSSLLRRLVVSPRSIDLLVLVPHFSIVLAVGHPDAD KLLVLVVE* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,505.266 | ||
| Theoretical pI: | 6.152 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 39.310 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.746 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.173 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344138.1 | complete | 127 | 660-277(-) |
Amino Acid sequence : | |||
| MGYEYEEIDTPWRNHKPPKKAAPAKIEDLLKDTMVGEEAFPLTLSQTARVLVRKTAKGKADEVLVLENIQIDPTKLVKFDVFVNDGDDEPKEVDRAEYAGSFAQLPHRVRSENTTKKSRI TDGFFRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,505.266 | ||
| Theoretical pI: | 6.152 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 39.310 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.746 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.173 | ||
| sheet | 0.260 | ||