| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344153.1 | complete | 151 | 53-508(+) |
Amino Acid sequence : | |||
| MGRMHSRGKGISASSLPYKRTPPSWLKISAQDVDENICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVES RIHRLARYYKKTKKLPPVWKYESTTASTLVA* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 17,107.954 | ||
| Theoretical pI: | 10.389 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 43.827 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.212 | ||
| sheet | 0.225 | ||