Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344153.1 | complete | 151 | 53-508(+) |
Amino Acid sequence : | |||
MGRMHSRGKGISASSLPYKRTPPSWLKISAQDVDENICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVES RIHRLARYYKKTKKLPPVWKYESTTASTLVA* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 17,107.954 | ||
Theoretical pI: | 10.389 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 43.827 | ||
aromaticity | 0.060 | ||
GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.212 | ||
sheet | 0.225 |