Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344166.1	internal	244	734-3(-)
Amino Acid sequence :
QLQHQVKGRLLLDVVVRQRAAVLELLAGKDQPLLIRGNALLVLDLGLDIVDGVRALNLKGDGLAGEGLDEDLHATTETEDKVEGGLLLDVIVSKGAAVLELLAGKDKPLLVRGNAFLVLN FRLDIVNGVGALDLQGDGFPGEGLDEDLHATTETEDQMEGGFLLDVVVGEGTAIFKLLAGKNQPLLVRGNALLVLDLSFDVVNRVGTLDFEGDGLASQGLDEDLHTSTETEDQMEGGRVL DVVI
Physicochemical properties
Number of amino acids:		244
Molecular weight:		15,549.809
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		124.318
aromaticity		0.035
GRAVY		-0.661
Secondary Structure Fraction
Helix		0.168
turn		0.413
sheet		0.161

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344166.1	internal	244	3-734(+)
Amino Acid sequence :
DYNIQNPSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL VLEL
Physicochemical properties
Number of amino acids:		244
Molecular weight:		15,549.809
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		124.318
aromaticity		0.035
GRAVY		-0.661
Secondary Structure Fraction
Helix		0.168
turn		0.413
sheet		0.161

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344166.1	complete	143	214-645(+)
Amino Acid sequence :
MAVPSPTTTSRRNPPSIWSSVSVVACKSSSRPSPGKPSPWRSRAPTPLTMSRRKFRTRKAFPRTSRGLSLPASSSRTAAPLLTITSRRSPPSTLSSVSVVACRSSSRPSPARPSPLRLRA LTPSTMSRPRSRTRRAFPRISRG*
Physicochemical properties
Number of amino acids:		143
Molecular weight:		15,549.809
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		124.318
aromaticity		0.035
GRAVY		-0.661
Secondary Structure Fraction
Helix		0.168
turn		0.413
sheet		0.161

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344166.1	internal	244	734-3(-)
Amino Acid sequence :
QLQHQVKGRLLLDVVVRQRAAVLELLAGKDQPLLIRGNALLVLDLGLDIVDGVRALNLKGDGLAGEGLDEDLHATTETEDKVEGGLLLDVIVSKGAAVLELLAGKDKPLLVRGNAFLVLN FRLDIVNGVGALDLQGDGFPGEGLDEDLHATTETEDQMEGGFLLDVVVGEGTAIFKLLAGKNQPLLVRGNALLVLDLSFDVVNRVGTLDFEGDGLASQGLDEDLHTSTETEDQMEGGRVL DVVI
Physicochemical properties
Number of amino acids:		244
Molecular weight:		15,549.809
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		124.318
aromaticity		0.035
GRAVY		-0.661
Secondary Structure Fraction
Helix		0.168
turn		0.413
sheet		0.161

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344166.1	internal	244	3-734(+)
Amino Acid sequence :
DYNIQNPSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL VLEL
Physicochemical properties
Number of amino acids:		244
Molecular weight:		15,549.809
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		124.318
aromaticity		0.035
GRAVY		-0.661
Secondary Structure Fraction
Helix		0.168
turn		0.413
sheet		0.161

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344166.1	complete	143	214-645(+)
Amino Acid sequence :
MAVPSPTTTSRRNPPSIWSSVSVVACKSSSRPSPGKPSPWRSRAPTPLTMSRRKFRTRKAFPRTSRGLSLPASSSRTAAPLLTITSRRSPPSTLSSVSVVACRSSSRPSPARPSPLRLRA LTPSTMSRPRSRTRRAFPRISRG*
Physicochemical properties
Number of amino acids:		143
Molecular weight:		15,549.809
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		124.318
aromaticity		0.035
GRAVY		-0.661
Secondary Structure Fraction
Helix		0.168
turn		0.413
sheet		0.161