Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344170.1	5prime_partial	114	3-347(+)
Amino Acid sequence :
SMFESVPKADPIMLMFVLHNWSDNECIDILKRCKEAIPAETGRVMIIDAIIDEDGEGDEFAGARLGLDVTMMAVTFEGKERTHREWAYILTEAGFRKYVVNNIKALESLIEAYP*
Physicochemical properties
Number of amino acids:		114
Molecular weight:		12,912.721
Theoretical pI:		4.613
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		32.504
aromaticity		0.088
GRAVY		-0.056
Secondary Structure Fraction
Helix		0.316
turn		0.167
sheet		0.333