| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344183.1 | 5prime_partial | 257 | 838-65(-) |
Amino Acid sequence : | |||
| KHKNLWKFWMIHMINYATVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQLLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASI IPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYNRNNGDGYTDP SFAKSNITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 30,184.302 | ||
| Theoretical pI: | 5.701 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66350 66475 | ||
| Instability index: | 39.053 | ||
| aromaticity | 0.140 | ||
| GRAVY | -0.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.202 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344183.1 | 5prime_partial | 257 | 838-65(-) |
Amino Acid sequence : | |||
| KHKNLWKFWMIHMINYATVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQLLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASI IPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYNRNNGDGYTDP SFAKSNITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 30,184.302 | ||
| Theoretical pI: | 5.701 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66350 66475 | ||
| Instability index: | 39.053 | ||
| aromaticity | 0.140 | ||
| GRAVY | -0.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.202 | ||
| sheet | 0.241 | ||