| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344194.1 | complete | 214 | 70-714(+) |
Amino Acid sequence : | |||
| MASINLLLIVALAIFSSVPAARGNSDGDALSAFRRSLTDPDKVLESWDPNLVTPCTWFHVTCNQDNRVTRVDLGNSNLSGHLVPDLGKLEHLQYLELYKNNIQGGIPAELSNLKNLISLD LYNNNISGTIPPSLGKLKSLVFLRLNDNQLNGPIPRTLAGISTLKVVDVSNNNLCGTIPTSGSFEHIPLNNFENNPRLEGPELQGLASYDTNCS* | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 23,247.031 | ||
| Theoretical pI: | 5.286 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 19.772 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.346 | ||
| sheet | 0.248 | ||