| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344200.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
| PTCNNPGLKPDTFILNAMINLYGRLGHLHKMEAVAAAMEGAGAGCKPDISTYNILINAYGRGGFMERMEEVFAGIEVRNLRPDVMTWTSRIGGYARKKMYGKCVEIFEEMIDSGCYPDGG TAKVLMSCCCNEEQIEQITGIIRNMHKLKHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 12,634.490 | ||
| Theoretical pI: | 4.975 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 81.369 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.264 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344200.1 | 3prime_partial | 146 | 438-1(-) |
Amino Acid sequence : | |||
| MHVPDNTSNLLNLLFITTTRHQHFGSPSIWITPTINHLLEYLHAFPVHLLPRIPSNPRRPRHHIRPQIPHLDPRKHLLHPLHEAPTPIGIDQDVVCADVGFAASAGALHGGCHRLHLVEV AKAAIEVDHGIEDERVGFEARIVACW | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 12,634.490 | ||
| Theoretical pI: | 4.975 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 81.369 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.264 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344200.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
| NMQQSWPQTRHVHPQCHDQPLWPPWPPPQDGGGGSRHGGRRRWLQTRHQHIQHPDQCLWAWGLHGEDGGGVCGDRGEESEAGCDDVDVEDWRVCEEEDVREMRGDIRGDD* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,634.490 | ||
| Theoretical pI: | 4.975 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 81.369 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.264 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344200.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
| PTCNNPGLKPDTFILNAMINLYGRLGHLHKMEAVAAAMEGAGAGCKPDISTYNILINAYGRGGFMERMEEVFAGIEVRNLRPDVMTWTSRIGGYARKKMYGKCVEIFEEMIDSGCYPDGG TAKVLMSCCCNEEQIEQITGIIRNMHKLKHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 12,634.490 | ||
| Theoretical pI: | 4.975 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 81.369 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.264 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344200.1 | 3prime_partial | 146 | 438-1(-) |
Amino Acid sequence : | |||
| MHVPDNTSNLLNLLFITTTRHQHFGSPSIWITPTINHLLEYLHAFPVHLLPRIPSNPRRPRHHIRPQIPHLDPRKHLLHPLHEAPTPIGIDQDVVCADVGFAASAGALHGGCHRLHLVEV AKAAIEVDHGIEDERVGFEARIVACW | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 12,634.490 | ||
| Theoretical pI: | 4.975 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 81.369 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.264 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344200.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
| NMQQSWPQTRHVHPQCHDQPLWPPWPPPQDGGGGSRHGGRRRWLQTRHQHIQHPDQCLWAWGLHGEDGGGVCGDRGEESEAGCDDVDVEDWRVCEEEDVREMRGDIRGDD* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,634.490 | ||
| Theoretical pI: | 4.975 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 81.369 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.264 | ||
| sheet | 0.155 | ||