Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344200.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
PTCNNPGLKPDTFILNAMINLYGRLGHLHKMEAVAAAMEGAGAGCKPDISTYNILINAYGRGGFMERMEEVFAGIEVRNLRPDVMTWTSRIGGYARKKMYGKCVEIFEEMIDSGCYPDGG TAKVLMSCCCNEEQIEQITGIIRNMHKLKHL* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 12,634.490 | ||
Theoretical pI: | 4.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
Instability index: | 81.369 | ||
aromaticity | 0.064 | ||
GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.264 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344200.1 | 3prime_partial | 146 | 438-1(-) |
Amino Acid sequence : | |||
MHVPDNTSNLLNLLFITTTRHQHFGSPSIWITPTINHLLEYLHAFPVHLLPRIPSNPRRPRHHIRPQIPHLDPRKHLLHPLHEAPTPIGIDQDVVCADVGFAASAGALHGGCHRLHLVEV AKAAIEVDHGIEDERVGFEARIVACW | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 12,634.490 | ||
Theoretical pI: | 4.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
Instability index: | 81.369 | ||
aromaticity | 0.064 | ||
GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.264 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344200.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
NMQQSWPQTRHVHPQCHDQPLWPPWPPPQDGGGGSRHGGRRRWLQTRHQHIQHPDQCLWAWGLHGEDGGGVCGDRGEESEAGCDDVDVEDWRVCEEEDVREMRGDIRGDD* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,634.490 | ||
Theoretical pI: | 4.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
Instability index: | 81.369 | ||
aromaticity | 0.064 | ||
GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.264 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344200.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
PTCNNPGLKPDTFILNAMINLYGRLGHLHKMEAVAAAMEGAGAGCKPDISTYNILINAYGRGGFMERMEEVFAGIEVRNLRPDVMTWTSRIGGYARKKMYGKCVEIFEEMIDSGCYPDGG TAKVLMSCCCNEEQIEQITGIIRNMHKLKHL* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 12,634.490 | ||
Theoretical pI: | 4.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
Instability index: | 81.369 | ||
aromaticity | 0.064 | ||
GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.264 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344200.1 | 3prime_partial | 146 | 438-1(-) |
Amino Acid sequence : | |||
MHVPDNTSNLLNLLFITTTRHQHFGSPSIWITPTINHLLEYLHAFPVHLLPRIPSNPRRPRHHIRPQIPHLDPRKHLLHPLHEAPTPIGIDQDVVCADVGFAASAGALHGGCHRLHLVEV AKAAIEVDHGIEDERVGFEARIVACW | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 12,634.490 | ||
Theoretical pI: | 4.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
Instability index: | 81.369 | ||
aromaticity | 0.064 | ||
GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.264 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344200.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
NMQQSWPQTRHVHPQCHDQPLWPPWPPPQDGGGGSRHGGRRRWLQTRHQHIQHPDQCLWAWGLHGEDGGGVCGDRGEESEAGCDDVDVEDWRVCEEEDVREMRGDIRGDD* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,634.490 | ||
Theoretical pI: | 4.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
Instability index: | 81.369 | ||
aromaticity | 0.064 | ||
GRAVY | -1.384 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.264 | ||
sheet | 0.155 |