| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344201.1 | 5prime_partial | 162 | 502-14(-) |
Amino Acid sequence : | |||
| ARGLVPNSARGSNMQQSGLKPDTFILNAMINLYGRLGHLHKMEAVAAAMEGAGAGCKPDISTYNILINAYGRGGFMERMEEVFAGIEVRNLRPDVMTWTSRIGGYARKKMYGKCVEIFEE MIDSGCYPDGGTAKVLMSCCCNEEQIEQITGIIRTIQKLKHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 13,851.894 | ||
| Theoretical pI: | 5.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 74.834 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.174 | ||
| turn | 0.240 | ||
| sheet | 0.165 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344201.1 | 5prime_partial | 121 | 500-135(-) |
Amino Acid sequence : | |||
| TRPRAEFGTRLQHATIRPQTRHVHPQCHDQPLWPPWPPPQDGGGGSRHGGRRRWLQTRHQHIQHPDQCLWAWGLHGEDGGGVCGDRGEESEAGCDDVDVEDWRVCEEEDVREMRGDIRGD D* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,851.894 | ||
| Theoretical pI: | 5.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 74.834 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.174 | ||
| turn | 0.240 | ||
| sheet | 0.165 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344201.1 | 5prime_partial | 162 | 502-14(-) |
Amino Acid sequence : | |||
| ARGLVPNSARGSNMQQSGLKPDTFILNAMINLYGRLGHLHKMEAVAAAMEGAGAGCKPDISTYNILINAYGRGGFMERMEEVFAGIEVRNLRPDVMTWTSRIGGYARKKMYGKCVEIFEE MIDSGCYPDGGTAKVLMSCCCNEEQIEQITGIIRTIQKLKHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 13,851.894 | ||
| Theoretical pI: | 5.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 74.834 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.174 | ||
| turn | 0.240 | ||
| sheet | 0.165 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344201.1 | 5prime_partial | 121 | 500-135(-) |
Amino Acid sequence : | |||
| TRPRAEFGTRLQHATIRPQTRHVHPQCHDQPLWPPWPPPQDGGGGSRHGGRRRWLQTRHQHIQHPDQCLWAWGLHGEDGGGVCGDRGEESEAGCDDVDVEDWRVCEEEDVREMRGDIRGD D* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,851.894 | ||
| Theoretical pI: | 5.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33250 | ||
| Instability index: | 74.834 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.174 | ||
| turn | 0.240 | ||
| sheet | 0.165 | ||