| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344202.1 | 3prime_partial | 158 | 161-634(+) |
Amino Acid sequence : | |||
| MTKIIPRNTTLPTSKSEVFSTAADSQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK EKRDAIDTKNQADSVVYQTEKQLKELGDKVPCTGKREG | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 12,385.265 | ||
| Theoretical pI: | 8.569 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 30.504 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.414 | ||
| turn | 0.243 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344202.1 | 5prime_partial | 111 | 634-299(-) |
Amino Acid sequence : | |||
| TFSFTGAGDFVPQFLQLLLCLVNHRIGLVLSIYRISLLLVFLGKFFGLTHHSLHLITGQCASTSNCDILLLPSSLIYGSDREYSIRINIKLDLDLRNTTGSRWNSIKAEAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,385.265 | ||
| Theoretical pI: | 8.569 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 30.504 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.414 | ||
| turn | 0.243 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344202.1 | 3prime_partial | 158 | 161-634(+) |
Amino Acid sequence : | |||
| MTKIIPRNTTLPTSKSEVFSTAADSQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK EKRDAIDTKNQADSVVYQTEKQLKELGDKVPCTGKREG | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 12,385.265 | ||
| Theoretical pI: | 8.569 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 30.504 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.414 | ||
| turn | 0.243 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344202.1 | 5prime_partial | 111 | 634-299(-) |
Amino Acid sequence : | |||
| TFSFTGAGDFVPQFLQLLLCLVNHRIGLVLSIYRISLLLVFLGKFFGLTHHSLHLITGQCASTSNCDILLLPSSLIYGSDREYSIRINIKLDLDLRNTTGSRWNSIKAEAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,385.265 | ||
| Theoretical pI: | 8.569 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 30.504 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
| Helix | 0.414 | ||
| turn | 0.243 | ||
| sheet | 0.243 | ||