Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344202.1 | 3prime_partial | 158 | 161-634(+) |
Amino Acid sequence : | |||
MTKIIPRNTTLPTSKSEVFSTAADSQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK EKRDAIDTKNQADSVVYQTEKQLKELGDKVPCTGKREG | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 12,385.265 | ||
Theoretical pI: | 8.569 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 30.504 | ||
aromaticity | 0.099 | ||
GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.243 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344202.1 | 5prime_partial | 111 | 634-299(-) |
Amino Acid sequence : | |||
TFSFTGAGDFVPQFLQLLLCLVNHRIGLVLSIYRISLLLVFLGKFFGLTHHSLHLITGQCASTSNCDILLLPSSLIYGSDREYSIRINIKLDLDLRNTTGSRWNSIKAEAT* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,385.265 | ||
Theoretical pI: | 8.569 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 30.504 | ||
aromaticity | 0.099 | ||
GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.243 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344202.1 | 3prime_partial | 158 | 161-634(+) |
Amino Acid sequence : | |||
MTKIIPRNTTLPTSKSEVFSTAADSQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK EKRDAIDTKNQADSVVYQTEKQLKELGDKVPCTGKREG | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 12,385.265 | ||
Theoretical pI: | 8.569 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 30.504 | ||
aromaticity | 0.099 | ||
GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.243 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344202.1 | 5prime_partial | 111 | 634-299(-) |
Amino Acid sequence : | |||
TFSFTGAGDFVPQFLQLLLCLVNHRIGLVLSIYRISLLLVFLGKFFGLTHHSLHLITGQCASTSNCDILLLPSSLIYGSDREYSIRINIKLDLDLRNTTGSRWNSIKAEAT* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,385.265 | ||
Theoretical pI: | 8.569 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 30.504 | ||
aromaticity | 0.099 | ||
GRAVY | 0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.243 | ||
sheet | 0.243 |