| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344206.1 | internal | 177 | 3-533(+) |
Amino Acid sequence : | |||
| LPITNHFHNSPLVRRRASSAVPLCCSLQTGGRRSGGYKPALWDFDSIQSLKTTNCEDERNLTKRVDLIGQVKKMLVEVGVNDVARLELIDELYRLGISWHFEDEIIQILNSSHRSGVDPA DLYSTSLGFRLLRQYGVPVSQEVFDCFKNDNGTNFKPSLGNDIKGLLQLYEPSFLQT | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,971.419 | ||
| Theoretical pI: | 6.474 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 50.126 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.266 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344206.1 | internal | 177 | 3-533(+) |
Amino Acid sequence : | |||
| LPITNHFHNSPLVRRRASSAVPLCCSLQTGGRRSGGYKPALWDFDSIQSLKTTNCEDERNLTKRVDLIGQVKKMLVEVGVNDVARLELIDELYRLGISWHFEDEIIQILNSSHRSGVDPA DLYSTSLGFRLLRQYGVPVSQEVFDCFKNDNGTNFKPSLGNDIKGLLQLYEPSFLQT | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,971.419 | ||
| Theoretical pI: | 6.474 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 50.126 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.266 | ||
| sheet | 0.215 | ||