| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344212.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| SLRTAHFPPEIAVARLKSALQKVMVAYDFLAGRLKPNPETGRLEIECKPSGAGFVLAATEYSLCEVGDLIYPNPAFMQLILLGLEKFDNHPLCVIQVTSFKCGGFAMGVSTNHALFDGLS FKHFLENLASQAFDYRPIATVPCHNRHLLAARSPPRVTFPHPELLNLKIPIGQEEKPPIFDCNQERLHFRILTLTPKHINFLKEKAKSASSAVKITIFNVIAAHIWRCKALSR | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 16,462.937 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 87.207 | ||
| aromaticity | 0.043 | ||
| GRAVY | -1.184 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.348 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344212.1 | 3prime_partial | 141 | 276-698(+) |
Amino Acid sequence : | |||
| MRYSGDIIQMWWFCNGRIHKPCIVRRSELQTLSRKPRFPSLRLPPHRHRPLPQPPPPRRPIAAARHLPPPGAPQPQNPHRPGRKTPNLRLQSGAPPLPNPNPNPQTHQFPQRESQIRLLR RQNHHLQRHRRPHLAVQGPLP | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 16,462.937 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 87.207 | ||
| aromaticity | 0.043 | ||
| GRAVY | -1.184 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.348 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344212.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| SLRTAHFPPEIAVARLKSALQKVMVAYDFLAGRLKPNPETGRLEIECKPSGAGFVLAATEYSLCEVGDLIYPNPAFMQLILLGLEKFDNHPLCVIQVTSFKCGGFAMGVSTNHALFDGLS FKHFLENLASQAFDYRPIATVPCHNRHLLAARSPPRVTFPHPELLNLKIPIGQEEKPPIFDCNQERLHFRILTLTPKHINFLKEKAKSASSAVKITIFNVIAAHIWRCKALSR | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 16,462.937 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 87.207 | ||
| aromaticity | 0.043 | ||
| GRAVY | -1.184 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.348 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344212.1 | 3prime_partial | 141 | 276-698(+) |
Amino Acid sequence : | |||
| MRYSGDIIQMWWFCNGRIHKPCIVRRSELQTLSRKPRFPSLRLPPHRHRPLPQPPPPRRPIAAARHLPPPGAPQPQNPHRPGRKTPNLRLQSGAPPLPNPNPNPQTHQFPQRESQIRLLR RQNHHLQRHRRPHLAVQGPLP | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 16,462.937 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 87.207 | ||
| aromaticity | 0.043 | ||
| GRAVY | -1.184 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.348 | ||
| sheet | 0.170 | ||