Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344235.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
LELPKXTLKSKMSGEDGAVVAEAPAPAPALGEPMDIMTALQLVLRKSRAHGGISRGLHEAAKLIEKHVAQLCVLAEDCDQADYVKLVKALCADHNVSLITVPSANTLGEWAGLCKIDSEG KARKAVGCSCLVVKDYGEESEGLHIVQEYVKSH* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,156.504 | ||
Theoretical pI: | 5.859 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 42.470 | ||
aromaticity | 0.026 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.197 | ||
sheet | 0.349 |