| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344235.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
| LELPKXTLKSKMSGEDGAVVAEAPAPAPALGEPMDIMTALQLVLRKSRAHGGISRGLHEAAKLIEKHVAQLCVLAEDCDQADYVKLVKALCADHNVSLITVPSANTLGEWAGLCKIDSEG KARKAVGCSCLVVKDYGEESEGLHIVQEYVKSH* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,156.504 | ||
| Theoretical pI: | 5.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 42.470 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.197 | ||
| sheet | 0.349 | ||