| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344240.1 | 5prime_partial | 149 | 717-268(-) |
Amino Acid sequence : | |||
| NVLSIVENINVAAIETTLWSIEWGIAEFVTHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLGLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPE EFRPERFLEEEAKVEANGNDFRYLPFGVG* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 13,683.654 | ||
| Theoretical pI: | 5.337 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 40.006 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.117 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.189 | ||
| sheet | 0.328 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344240.1 | complete | 122 | 115-483(+) |
Amino Acid sequence : | |||
| MLQNVKTELATFLRRIDLLLPWWRQQLEVLYESAQRNTQNRQCKDNTRAAPSADAEGEVPKVIAIGLDFSLLLQESLGPELLGLFPLGRVVGKPPRIHQDLALGRDVVATELCIMEVHVG DQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,683.654 | ||
| Theoretical pI: | 5.337 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 40.006 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.117 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.189 | ||
| sheet | 0.328 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344240.1 | 5prime_partial | 149 | 717-268(-) |
Amino Acid sequence : | |||
| NVLSIVENINVAAIETTLWSIEWGIAEFVTHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLGLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPE EFRPERFLEEEAKVEANGNDFRYLPFGVG* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 13,683.654 | ||
| Theoretical pI: | 5.337 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 40.006 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.117 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.189 | ||
| sheet | 0.328 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344240.1 | complete | 122 | 115-483(+) |
Amino Acid sequence : | |||
| MLQNVKTELATFLRRIDLLLPWWRQQLEVLYESAQRNTQNRQCKDNTRAAPSADAEGEVPKVIAIGLDFSLLLQESLGPELLGLFPLGRVVGKPPRIHQDLALGRDVVATELCIMEVHVG DQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,683.654 | ||
| Theoretical pI: | 5.337 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 40.006 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.117 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.189 | ||
| sheet | 0.328 | ||